PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100095440031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 278aa    MW: 30606.1 Da    PI: 7.6392
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100095440031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof742e-23931302663
                        zf-Dof  26 lsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                   lsqPryfCk+CrryWtkGG+lrnvPvGgg+rk k+sss
  Ote100095440031|100095440031  93 LSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKTKRSSS 130
                                   79********************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-1358126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088417.2973127IPR003851Zinc finger, Dof-type
PfamPF027015.5E-1893127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MITSSSDLSL STKRNSWIPF EAEVISRSFC CMAMDSSTAQ SLHQEVGPQT LESMLGSTKP  60
QQEKKPRPAE QSXXXXXXXX XXXXXXXXXX XXLSQPRYFC KSCRRYWTKG GTLRNVPVGG  120
GCRKTKRSSS SSSSRXXXXX XXXXXXXXXX XXXXXXXNLA IPPGRLGLDD PSFPVPGNPC  180
MSLGDCGLID ALRSGTFLEF PRGLQNLYGG NGLEYGAGLG MGGLNEEMGF EELSSGGRVK  240
QEICNGDGTW WENGELDTHT RIGFCSSTWH GLLNTPLM
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419